Transcript | Ll_transcript_379404 |
---|---|
CDS coordinates | 109-1317 (+) |
Peptide sequence | MASRPIVPLQPQQAKGEGVIGGRRKQENKNGAANGKNRVVLGDIGNLDRVKGANINLNRPITRSLCAQLLAKAEAGENDKNLAIPNVTGPKPQVADGVVAKRRVAPKPAEKKVTAKPKPVEIVEISSGKEVQKDKSANKNKEQGDALSKKKSQTLTSVLTARSKAACGLTEKPKDQIIDIDAGDSRNELAAVEYIEDMYKFYKLAENENRPHQYMDSQPEINERMRAILVDWLIDVQTKFDLSLETLYLTINIVDRFLAVKTVLRRELQLVGVSAMLMASKYEEIWPPEVNDFVCLTDRAYTHEQILVMEKIILGKLEWTLTVPTTFVFLTRFIKASVPDQELENMGHFLSELGMMHYATLVYCPSMVAASAVFAARCTLNKTPIWNETLQLHTGYSEEQLM* |
ORF Type | complete |
Blastp | G2/mitotic-specific cyclin S13-6 from Soja with 70.1% of identity |
---|---|
Blastx | G2/mitotic-specific cyclin S13-6 from Soja with 65.51% of identity |
Eggnog | g2 mitotic-specific(COG5024) |
Kegg | Link to kegg annotations (547920) |
CantataDB | Link to cantataDB annotations (CNT0001529) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425555.1) |
Pfam | Cyclin, N-terminal domain (PF00134.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer