Protein coding transcript 937

• Transcript: Ll_transcript_293688
• CDS coordinates: 2-496 (+)
• Peptide sequence: IISAGGVQPDQEKIRAMVDWPQSRSLSTLRGFFGLTSFYRKFVLHYATLAAPLTELLKHHKFTWTTEAQLAFTTLKNAMTKTLVLQLSNFSASFEMEIDAFAVAIGAVLSQCGHPIAFFSKKMVSRMQHASAYVWEMFVVIEAVKKWRRYLIGMKLPLSHIHKF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_293688

• Blastp: Retrovirus-related Pol polyprotein from transposon 297 from Sophophora with 35.15% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon 297 from Sophophora with 35.15% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450597.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;