Transcript | Ll_transcript_378104 |
---|---|
CDS coordinates | 736-1305 (+) |
Peptide sequence | MNPNLSNDKVIDESCWSDKEYCRKTENWYCFSKAEAEEQALEFAKRTGLSVVSICPSLILGPILQSAKVNASSLVLLNILKGCESLENKHRWIVDVRDLADAILLAYENLAAEGRYLCTSHFIKTKDLVEKLKSIYPNNNYPTNFIEVDDYTRLSSEKLQKLGWKYRPLEETLIDSVESYMEAGILESK* |
ORF Type | complete |
Blastp | Cinnamoyl-CoA reductase 1 from Oryza sativa with 35.94% of identity |
---|---|
Blastx | Cinnamoyl-CoA reductase 2 from Arabidopsis with 39.93% of identity |
Eggnog | Nad-dependent epimerase dehydratase(COG0451) |
Kegg | Link to kegg annotations (4331085) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443362.1) |
Pfam | NAD dependent epimerase/dehydratase family (PF01370.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer