Protein coding transcript 93771

• Transcript: Ll_transcript_378104
• CDS coordinates: 736-1305 (+)
• Peptide sequence: MNPNLSNDKVIDESCWSDKEYCRKTENWYCFSKAEAEEQALEFAKRTGLSVVSICPSLILGPILQSAKVNASSLVLLNILKGCESLENKHRWIVDVRDLADAILLAYENLAAEGRYLCTSHFIKTKDLVEKLKSIYPNNNYPTNFIEVDDYTRLSSEKLQKLGWKYRPLEETLIDSVESYMEAGILESK*
• ORF Type: complete

Annotations of Ll_transcript_378104

• Blastp: Cinnamoyl-CoA reductase 1 from Oryza sativa with 35.94% of identity
• Blastx: Cinnamoyl-CoA reductase 2 from Arabidopsis with 39.93% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (4331085)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443362.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;