Protein coding transcript 93786

• Transcript: Ll_transcript_379740
• CDS coordinates: 251-607 (+)
• Peptide sequence: MGEEDKVEEKKKETIEEKKEEETPEIVLKVDMHCQACARKIAKALKGFEGVEEVTADSKTSKVVVKGKEANPIKVLERLQKKSGKKVELISPLPKPQEEKKEEIKEPQPVEKKEEVNH*
• ORF Type: complete

Annotations of Ll_transcript_379740

• Blastp: Heavy metal-associated isoprenylated plant protein 7 from Arabidopsis with 61.19% of identity
• Blastx: Heavy metal-associated isoprenylated plant protein 7 from Arabidopsis with 60.94% of identity
• Eggnog: heavy metal transport detoxification protein(COG2608)
• Kegg: Link to kegg annotations (AT5G63530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419188.1)
• Pfam: Heavy-metal-associated domain (PF00403.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;