Transcript | Ll_transcript_379746 |
---|---|
CDS coordinates | 251-652 (+) |
Peptide sequence | MGEEDKVEEKKKETIEEKKEEETPEIVLKVDMHCQACARKIAKALKGFEGVEEVTADSKTSKVVVKGKEANPIKVLERLQKKSGKKVELISPLPKPQEEKKEEIKEPQPVEKKEEVSPPPVVTVVLKVGMHCEA |
ORF Type | 3prime_partial |
Blastp | Heavy metal-associated isoprenylated plant protein 8 from Arabidopsis with 39.57% of identity |
---|---|
Blastx | Heavy metal-associated isoprenylated plant protein 7 from Arabidopsis with 60.32% of identity |
Eggnog | heavy metal transport detoxification protein(COG2608) |
Kegg | Link to kegg annotations (AT3G02960) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419188.1) |
Pfam | Heavy-metal-associated domain (PF00403.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer