| Transcript | Ll_transcript_293689 |
|---|---|
| CDS coordinates | 2-310 (+) |
| Peptide sequence | IISAGGVQPDQEKIRAMVDWPQSRSLSTLRGFFGLTSFYRKFVLHYATLAAPLTELLKHHKFTWTTEAQLAFTTLKNAMTKTSVLQLPDFSASFEVETDASAV |
| ORF Type | internal |
| Blastp | Uncharacterized mitochondrial protein AtMg00860 from Arabidopsis with 50% of identity |
|---|---|
| Blastx | Uncharacterized mitochondrial protein AtMg00860 from Arabidopsis with 50% of identity |
| Eggnog | Retrotransposon protein(COG2801) |
| Kegg | Link to kegg annotations (ArthMp075) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019450597.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer