Protein coding transcript 93825

• Transcript: Ll_transcript_378613
• CDS coordinates: 2817-3734 (+)
• Peptide sequence: MDGGRQHQNCRQKIEYYRGAHSPWNMDAQHQREVKEPNALVMNKKIRSIMAEKQAAILELELEAAISEKNEALAARDLAFRQRDEALAQRDNAVMERDIALAALQKRNNAVNFPSGGVQCGSKRMHQAAYRTKDMPVRDATPVTVITAEAVKSRQAKRLKENMVINSKASKSPTKLGEDLNRHASSQGTKIKSEWDKLDVGLKLVAFDETIMPAPVCTCTGVPRQCYKWGSGGWQSSCCTTAMSMYPLPQLPNKRHARIGGRKMSGSVFTRLLSRLASEGHDLSTPLDLKSYWARHGTNRYITIK*
• ORF Type: complete

Annotations of Ll_transcript_378613

• Blastp: Protein BASIC PENTACYSTEINE4 from Arabidopsis with 55.37% of identity
• Blastx: Protein BASIC PENTACYSTEINE4 from Arabidopsis with 54.4% of identity
• Eggnog: Transcriptional activator(ENOG41116WE)
• Kegg: Link to kegg annotations (AT2G21240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463241.1)
• Pfam: GAGA binding protein-like family (PF06217.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;