Protein coding transcript 93826

• Transcript: Ll_transcript_378614
• CDS coordinates: 2972-3814 (+)
• Peptide sequence: MDAQHQREVKEPNALVMNKKIRSIMAEKQAAILELELEAAISEKNEALAARDLAFRQRDEALAQRDNAVMERDIALAALQKRNNAVNFPSGGVQCGSKRMHQAAYRTKDMPVRDATPVTVITAEAVKSRQAKRLKENMVINSKASKSPTKLGEDLNRHASSQGTKIKSEWDKLDVGLKLVAFDETIMPAPVCTCTGVPRQCYKWGSGGWQSSCCTTAMSMYPLPQLPNKRHARIGGRKMSGSVFTRLLSRLASEGHDLSTPLDLKSYWARHGTNRYITIK*
• ORF Type: complete

Annotations of Ll_transcript_378614

• Blastp: Protein BASIC PENTACYSTEINE5 from Arabidopsis with 56.72% of identity
• Blastx: Protein BASIC PENTACYSTEINE4 from Arabidopsis with 55.28% of identity
• Eggnog: GAGA binding protein-like family(ENOG41108JK)
• Kegg: Link to kegg annotations (AT4G38910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463299.1)
• Pfam: GAGA binding protein-like family (PF06217.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;