Transcript | Ll_transcript_379780 |
---|---|
CDS coordinates | 238-1071 (+) |
Peptide sequence | MIGCGGFWRKVFMMSSGATELNTFYPIRPECQSDVPPTRFKPRAGKTLSARRWHASFSADGRLNIAKVLRRIQRGGVHPSIKGVVWEFLLGCYDPNSTFDERNELMQRRRGQYDMWKAECQKMVPAIGSGKFITTPLVGDDGKPTDPSLIGVSTSDKKVLQWMQVLHQIGLDVVRTDRALEFYESEANQAKLWDVLAVFAWLNNDIGYVQGMNDICSPLIILIENEADCFWCFERAMRRLRENFRCSASSMGVQSQLSTLSQIMKTVDPKLHQHLGM* |
ORF Type | complete |
Blastp | TBC1 domain family member 15 from Mus with 29.44% of identity |
---|---|
Blastx | TBC1 domain family member 15 from Mus with 27.27% of identity |
Eggnog | TBC1 domain family member(COG5210) |
Kegg | Link to kegg annotations (66687) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459238.1) |
Pfam | Rab-GTPase-TBC domain (PF00566.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer