Protein coding transcript 939

• Transcript: Ll_transcript_293693
• CDS coordinates: 2-379 (+)
• Peptide sequence: PNGTAQAKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDVTNQDTFGRAKSWVKELQRQASPNIVIALAGNKS
• ORF Type: internal

Annotations of Ll_transcript_293693

• Blastp: Ras-related protein Rab-5B from Gallus with 90.55% of identity
• Blastx: Ras-related protein Rab-5B from Gallus with 90.55% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (100529061)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460953.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;