Protein coding transcript 93912

• Transcript: Ll_transcript_379765
• CDS coordinates: 1759-2460 (+)
• Peptide sequence: MNDICSPLIILIENEADCFWCFERAMRRLRENFRCSASSMGVQSQLSTLSQIMKTVDPKLHQHLEDLDGGEYLFAFRMLMVLFRREFSFADTLYLWELMWGMEYNPNIFSKYEDPDRTKAKESSSAINDKMLKQYGKFERKNVKTGHTEESYSLAIFLVASVLEIKNRRILNEAKGVDDVVQILGDITSNLDAKKACTEALKIQKKYLSKVVFIFYLPWTCLRKSRGSFLENK*
• ORF Type: complete

Annotations of Ll_transcript_379765

• Blastp: TBC1 domain family member 15 from Mus with 43% of identity
• Blastx: TBC1 domain family member 15 from Mus with 42.47% of identity
• Eggnog: TBC1 domain family member(COG5210)
• Kegg: Link to kegg annotations (66687)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459238.1)
• Pfam: Rab-GTPase-TBC domain (PF00566.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;