Transcript | Ll_transcript_379576 |
---|---|
CDS coordinates | 219-1412 (+) |
Peptide sequence | MSSSGGGESLSSDKQKEKARVSRTSLILWHAHQNDASSVRKLLQEDPSLVNATDYDNRTPLHVASLHGWLDVANCLIQFGADVNAQDRWKNTPLADAEGAKKNSVIQLLKKHGGSSYGQNGSHFEPNTVPPPLPNKCDWEVDPSELDFSNSARIGKGSFGEILKAHWRGTPVAVKRILPSLSEDRLVIQDFRHEVNLLVKLRHPNIVQFRGAVTDRKPLMLITEYLRGGDLHQYLKDKGSLNTASAINFSMDIARGMAYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQSSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFANYEPLDGAKRAAEGHRPTIRAKGYTPELIELTEQCWAADMNQRPS |
ORF Type | 3prime_partial |
Blastp | Serine/threonine-protein kinase STY17 from Arabidopsis with 35.05% of identity |
---|---|
Blastx | Serine/threonine-protein kinase STY17 from Arabidopsis with 35.05% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT4G35780) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432157.1) |
Pfam | Ankyrin repeats (3 copies) (PF12796.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer