Protein coding transcript 93926

• Transcript: Ll_transcript_379579
• CDS coordinates: 279-1121 (+)
• Peptide sequence: MSSSGGESTSSDKQKEKARVSRTSLILWHAHQNDAASVRKLLQEDPSLVNARDYDNRTPLHVASLHGWIDVANCLIEFGADVNAQDRWKNTPLADAEGAKRNSMIQLLKTHGGSSYGQNGSHFEPNTVPPPLPNKCDWEVDPSELDFSNSARIGKGSFGEILKAHWRGTPVAVKRILPSLSEDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTDRKPLMLITEYLRGGDLHQYLKEKGSLNPATAINFSMDIARGMAYLHNEPNVIIHRDLKPRYAYMKA*
• ORF Type: complete

Annotations of Ll_transcript_379579

• Blastp: Serine/threonine-protein kinase TNNI3K from Pongo with 30.47% of identity
• Blastx: Serine/threonine-protein kinase TNNI3K from Pongo with 29.79% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (100174232)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445929.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;