Protein coding transcript 93932

• Transcript: Ll_transcript_379588
• CDS coordinates: 1-507 (+)
• Peptide sequence: WKNTPLADAEGAKRNSMIQLLKTHGGSSYGQNGSHFEPNTVPPPLPNKCDWEVDPSELDFSNSARIGKGSFGEILKAHWRGTPVAVKRILPSLSEDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTDRKPLMLITEYLRGGDLHQYLKDKGSLNTASAINFSMDIARGM
• ORF Type: internal

Annotations of Ll_transcript_379588

• Blastp: Probable serine/threonine-protein kinase DDB_G0271538 from Dictyostelium with 38.93% of identity
• Blastx: Probable serine/threonine-protein kinase DDB_G0271538 from Dictyostelium with 38.93% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (DDB_G0271538)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445929.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;