Protein coding transcript 93935

• Transcript: Ll_transcript_379563
• CDS coordinates: 219-1064 (+)
• Peptide sequence: MSSSGGGESLSSDKQKEKARVSRTSLILWHAHQNDASSVRKLLQEDPSLVNATDYDNRTPLHVASLHGWLDVANCLIQFGADVNAQDRWKNTPLADAEGAKKNSVIQLLKKHGGSSYGQNGSHFEPNTVPPPLPNKCDWEVDPSELDFSNSARIGKGSFGEILKAHWRGTPVAVKRILPSLSEDRLVIQDFRHEVNLLVKLRHPNIVQFRGAVTDRKPLMLITEYLRGGDLHQYLKDKGSLNTASAINFSMDIARGMAYLHNEPNVIIHRDLKPRYAYMKA*
• ORF Type: complete

Annotations of Ll_transcript_379563

• Blastp: Probable serine/threonine-protein kinase drkD from Dictyostelium with 45.26% of identity
• Blastx: Probable serine/threonine-protein kinase drkD from Dictyostelium with 45.26% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (DDB_G0281557)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432157.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;