Transcript | Ll_transcript_379569 |
---|---|
CDS coordinates | 279-1469 (+) |
Peptide sequence | MSSSGGESTSSDKQKEKARVSRTSLILWHAHQNDAASVRKLLQEDPSLVNARDYDNRTPLHVASLHGWIDVANCLIEFGADVNAQDRWKNTPLADAEGAKRNSMIQLLKTHGGSSYGQNGSHFEPNTVPPPLPNKCDWEVDPTELDFSNSARIGKGSFGEILKAHWRGTPVAVKRILPSLSEDRLVIQDFRHEVNLLVKLRHPNIVQFRGAVTDRKPLMLITEYLRGGDLHQYLKEKGSLNPASAINFSMDIARGMAYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQSSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFATYEPYDGAKRAAEGHRPTIRAKGYTPELIELTEQCWAADMNQRPS |
ORF Type | 3prime_partial |
Blastp | Serine/threonine-protein kinase STY8 from Arabidopsis with 33.13% of identity |
---|---|
Blastx | Serine/threonine-protein kinase STY8 from Arabidopsis with 33.64% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT2G17700) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445929.1) |
Pfam | Ankyrin repeats (3 copies) (PF12796.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer