Protein coding transcript 93939

• Transcript: Ll_transcript_379569
• CDS coordinates: 279-1469 (+)
• Peptide sequence: MSSSGGESTSSDKQKEKARVSRTSLILWHAHQNDAASVRKLLQEDPSLVNARDYDNRTPLHVASLHGWIDVANCLIEFGADVNAQDRWKNTPLADAEGAKRNSMIQLLKTHGGSSYGQNGSHFEPNTVPPPLPNKCDWEVDPTELDFSNSARIGKGSFGEILKAHWRGTPVAVKRILPSLSEDRLVIQDFRHEVNLLVKLRHPNIVQFRGAVTDRKPLMLITEYLRGGDLHQYLKEKGSLNPASAINFSMDIARGMAYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQSSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFATYEPYDGAKRAAEGHRPTIRAKGYTPELIELTEQCWAADMNQRPS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_379569

• Blastp: Serine/threonine-protein kinase STY8 from Arabidopsis with 33.13% of identity
• Blastx: Serine/threonine-protein kinase STY8 from Arabidopsis with 33.64% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G17700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445929.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;