Protein coding transcript 940

• Transcript: Ll_transcript_445109
• CDS coordinates: 72-497 (+)
• Peptide sequence: MPEIPKEQWAQVIQKTGGPVEYKKIPVEQPGPDEVLVNIKYSGVCHTDLHAVNGDWPLATKLPLVGGHEGAGVVVARGDLVTDVEIGDYAGVKWLNGSCLACDFCQQADEPLCPKPLLSGYTVDGTFQQYCIAKAAHVARIP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_445109

• Blastp: Alcohol dehydrogenase 1 from Neurospora with 80% of identity
• Blastx: Alcohol dehydrogenase 1 from Neurospora with 80% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (NCU01754)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464294.1)
• Pfam: Alcohol dehydrogenase GroES-like domain (PF08240.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;