Protein coding transcript 94059

• Transcript: Ll_transcript_377976
• CDS coordinates: 3-341 (+)
• Peptide sequence: TIAEVIENEWFKKGYKPPRFEQANVSLDDINSIFSESMDSQNLVVERRTEGPVAPVTMNAFELISTSQGLNLSSLFEKQMVCLSLLEKSNCMAFTSLEFCISEKLMWIGLRE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_377976

• Blastp: CBL-interacting serine/threonine-protein kinase 23 from Arabidopsis with 77.5% of identity
• Blastx: CBL-interacting serine/threonine-protein kinase 23 from Arabidopsis with 77.5% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G30270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417188.1)
• Pfam: NAF domain (PF03822.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;