Protein coding transcript 94070

• Transcript: Ll_transcript_377982
• CDS coordinates: 52-906 (+)
• Peptide sequence: MSPSTLLSLHTLTKLSTLTFEPPPSLNHSTPSHFLSHNSYLYLSFHFNFISMGIKIFMFSFIVTSILFYLLFIPISTFNPAINYFNISSKTTKAYPVTFAYLISASTGDAVKLKRLLKVLYHPGNYYLIHMDYGAPGEEHRDIAEYVASDPVFGKVGNVWIVGKPNLVTYRGPTMLATTLHAMSMLLRICHWDWFINLSASDYPLVTQDDLIQAFSELPRDINFIQHSSRLGWKLNKRGKPMIIDPGLYSLNKSDIWWIIKQRNLPTSFKLYTVSCHKCWKVIK*
• ORF Type: complete

Annotations of Ll_transcript_377982

• Blastp: Beta-glucuronosyltransferase GlcAT14B from Arabidopsis with 56.42% of identity
• Blastx: Beta-glucuronosyltransferase GlcAT14A from Arabidopsis with 55.81% of identity
• Eggnog: Glucosaminyl (N-acetyl) transferase(ENOG410XQ7M)
• Kegg: Link to kegg annotations (AT5G15050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430808.1)
• Pfam: Core-2/I-Branching enzyme (PF02485.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;