Protein coding transcript 94093

• Transcript: Ll_transcript_379484
• CDS coordinates: 680-1486 (+)
• Peptide sequence: MMKSAKDGAQDEEIENEEAFFLKKESQRELKVKVDGKSTEQKPNTPRSKHSATEQRRRSKINDRFHMLRELIPHGDQKRDKASFLLEVIEYIHFLQEKVHKYEGSFQGWSHEPEKLMPWSNNDTPAESFEHRGANSGSGPSPSFLFASKTEEKNITIPLKTPGSIQNVESGLDTGTNFKTMDHHPGITNKAFPVPISPQPNFFTPTQSGGQDGMMSQLTHRLAFDVENAIYQPSDECQTLTATSEKLKDKELTIEGGAISISSVYSKG*
• ORF Type: complete

Annotations of Ll_transcript_379484

• Blastp: Transcription factor BIM1 from Arabidopsis with 43.32% of identity
• Blastx: Transcription factor BIM1 from Arabidopsis with 43.66% of identity
• Eggnog: Transcription factor(ENOG411216Z)
• Kegg: Link to kegg annotations (AT5G08130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464199.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;