Protein coding transcript 94098

• Transcript: Ll_transcript_379461
• CDS coordinates: 3-620 (+)
• Peptide sequence: CTGSRLKTQDFLQPLERAEPKASAKEEATDEISSVAPKPPPPPPPSVEHLLPGGIGTYSISHISYSNNIHRVPKPETSTSLFSVHQATSTDRNDENSNCSSYTSSGFTLWEESAVKKGKTGKENNVASKPILGVAESAAKPGQWTLSERTSQSFSNNHHNSVNSRSSSQLVLRFLFLLFHGASFFFIFFIGKELRLKACYLHFYA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_379461

• Blastp: Transcription factor BIM1 from Arabidopsis with 51.22% of identity
• Blastx: Transcription factor BIM1 from Arabidopsis with 48.08% of identity
• Eggnog: Transcription factor(ENOG411216Z)
• Kegg: Link to kegg annotations (AT5G08130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464195.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;