Transcript | Ll_transcript_379454 |
---|---|
CDS coordinates | 628-1527 (+) |
Peptide sequence | MELPQARAFGTQGRKPMHDFLSLYSNSTTQQDSRPPSQVCTGSRLKTQDFLQPLERADAKASAKEEATDEISSATPKPLPPTPPSVEHILPGGIGTYSISHISNFNNIQRVPKPEASLFTVHQANSADRNDENSNCSSYTSSGFTLWEESAVKKGKTGKENNVAEKPILVDSAAKSGQWTLSERTSQSFSNNRHNSFNSRSTSQTTGQKNQSFIEMMKSAEDGAQDEELENEETFFLNKEFQRELKVKVDGKSTDQKPNTPRSKHSATEQRRRSKINDRQVLATTMIKVFQDPRRGAWG* |
ORF Type | complete |
Blastp | Transcription factor BIM1 from Arabidopsis with 51.13% of identity |
---|---|
Blastx | Transcription factor BIM1 from Arabidopsis with 49.18% of identity |
Eggnog | Transcription factor(ENOG411216Z) |
Kegg | Link to kegg annotations (AT5G08130) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451881.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer