| Transcript | Ll_transcript_378785 |
|---|---|
| CDS coordinates | 2314-2616 (+) |
| Peptide sequence | MHPMISRRWGTNFCIHRGWSDQIMGINNSLDKMRLKILTSIFFFRFSNLICCFNPQLRVFHKLTGKLTRGIILGSSSPEQLIAKLKVLVTYELTLDDIQI* |
| ORF Type | complete |
| Blastp | Probable protein transport Sec1a from Oryza sativa with 65.12% of identity |
|---|---|
| Blastx | SNARE-interacting protein KEULE from Arabidopsis with 85% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (4335313) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020216524.1) |
| Pfam | - |
| Rfam | tRNA (RF00005) |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer