Protein coding transcript 94147

• Transcript: Ll_transcript_379605
• CDS coordinates: 153-659 (+)
• Peptide sequence: MKFHSKWLCLPCSLTLAIFPLAAFFVEKLAQRKYISETVVVLLHIIITTTTLLYPVLVILRCDSAFVFGVALMLFACIVWLKLVSYAHTNYDLRAISKSTEKGEAVTSTLNIDYTYDVSFKSLVYFTVAPTLCYQPSYPRTPSIRKGWLLRQIVKLIIFTGVMGFIIEQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_379605

• Blastp: Diacylglycerol O-acyltransferase 1B from Soja with 76.83% of identity
• Blastx: Diacylglycerol O-acyltransferase 1A from Soja with 76.22% of identity
• Eggnog: Oacyltransferase(COG5056)
• Kegg: Link to kegg annotations (732606)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443005.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;