Transcript | Ll_transcript_379606 |
---|---|
CDS coordinates | 2136-2660 (+) |
Peptide sequence | MGFIIEQYMNPIVQNSQHPLKGNILYASERVLKLSVPNVYVWLCMFYCFFHLWLNILAELLRFGDREFYKDWWNAKTVEEYWRMWNMPVHKWMVRHVYFPCIRNGLPKPAATLVAFLVSAVFHELCIAIPCHMFKLWAFIGIMFQVKVYFIAIFYFVCLFRVESLPSCMEKRLK* |
ORF Type | complete |
Blastp | Diacylglycerol O-acyltransferase 1B from Soja with 65.84% of identity |
---|---|
Blastx | Diacylglycerol O-acyltransferase 1C from Soja with 87.64% of identity |
Eggnog | Oacyltransferase(COG5056) |
Kegg | Link to kegg annotations (732606) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443005.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer