| Transcript | Ll_transcript_379611 |
|---|---|
| CDS coordinates | 2-355 (+) |
| Peptide sequence | RCDSAFVFGVALMLFACIVWLKLVSYAHTNYDLRAISKSTEKGEAVTSTLNIDYTYDVSFKSLVYFTVAPTLCYQSVYCITGMDLRGMRFLARGQVRMCQAEIITQLAIKLVSSNHY* |
| ORF Type | 5prime_partial |
| Blastp | Diacylglycerol O-acyltransferase 1A from Soja with 70% of identity |
|---|---|
| Blastx | Diacylglycerol O-acyltransferase 1A from Soja with 70% of identity |
| Eggnog | Oacyltransferase(COG5056) |
| Kegg | Link to kegg annotations (548005) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019443014.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer