| Transcript | Ll_transcript_379618 |
|---|---|
| CDS coordinates | 2356-2691 (+) |
| Peptide sequence | MPVHKWMIRHLYFPCLRNGIPKGVALLIAFLVSALFHELCIAVPCHIFKWWAFIGIMFQVPVVLITNYVQNKFQNSMVGNMTFWFTFCILGQPMCVLLYYHDLMNREGKVG* |
| ORF Type | complete |
| Blastp | Diacylglycerol O-acyltransferase 1B from Soja with 65.84% of identity |
|---|---|
| Blastx | Diacylglycerol O-acyltransferase 1B from Soja with 87.5% of identity |
| Eggnog | Oacyltransferase(COG5056) |
| Kegg | Link to kegg annotations (732606) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019443014.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer