Protein coding transcript 94162

• Transcript: Ll_transcript_379622
• CDS coordinates: 2095-2688 (+)
• Peptide sequence: MGFIIEQYMNPIVQNSQHPLKGNILYASERVLKLSVPNVYVWLCMFYCFFHLWLNILAELLRFGDREFYKDWWNAKTVEEYWRMWNMPVHKWMVRHVYFPCIRNGLPKPAATLVAFLVSAVFHELCIAIPCHMFKLWAFIGIMFQVPLVLITNYLQNKFRNSMVGNMIFWFIFCIFGQPMCVLLYYHDLMNRKGELD*
• ORF Type: complete

Annotations of Ll_transcript_379622

• Blastp: Diacylglycerol O-acyltransferase 1B from Soja with 57.59% of identity
• Blastx: Diacylglycerol O-acyltransferase 1C from Soja with 90.58% of identity
• Eggnog: Oacyltransferase(COG5056)
• Kegg: Link to kegg annotations (732606)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416835.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;