Protein coding transcript 9417

• Transcript: Ll_transcript_334927
• CDS coordinates: 113-424 (+)
• Peptide sequence: MVDPVLNMNYSKDEVLKFLKVGLLCVQEKANLRPTMFEVVEKLTNNFYMQDVHITKPGLVSDLRTIRIKQKMEMNSSSPSKQESNSIGVTFSSSIWSMSNLAR*
• ORF Type: complete

Annotations of Ll_transcript_334927

• Blastp: Cold-responsive protein kinase 1 from Arabidopsis with 32.93% of identity
• Blastx: Cold-responsive protein kinase 1 from Arabidopsis with 39.02% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G16670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432268.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;