Protein coding transcript 94176

• Transcript: Ll_transcript_377349
• CDS coordinates: 756-1205 (+)
• Peptide sequence: MPRGTLEVVLVSAKGLDGNDFLSSVDPYVILRYRAQEHKSTVKEGDGSSPKWNESFLFTVSDSASELNLRIMDKDHFSKDDFLGEAIIPIDAVVAEGSIPETAYNVVKDEDYRGEIKVALTFTPEPERYDDRYKAEENYGGWTQFNRDI*
• ORF Type: complete

Annotations of Ll_transcript_377349

• Blastp: Elicitor-responsive protein 3 from Oryza sativa with 56.94% of identity
• Blastx: Elicitor-responsive protein 3 from Oryza sativa with 56.94% of identity
• Eggnog: Domain-Containing protein(COG5038)
• Kegg: Link to kegg annotations (4336487)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434216.1)
• Pfam: C2 domain (PF00168.29)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;