| Transcript | Ll_transcript_377355 |
|---|---|
| CDS coordinates | 547-999 (+) |
| Peptide sequence | MPRGTLEVVLVSAKGLEDNDFLSSIDPYVILTFRAQEHKSTVKEGGGSNPLWNEIFLFTVSDSASELNLKIMEKDNFNQDDFLGEAIIPIDAVIEEGSIPETAYNVVKNEEYCGEIKLALTFNAEPERNDDQDYNTEESYGGWTESNTDT* |
| ORF Type | complete |
| Blastp | C2 domain-containing protein At1g63220 from Arabidopsis with 60.27% of identity |
|---|---|
| Blastx | C2 domain-containing protein At1g63220 from Arabidopsis with 60.27% of identity |
| Eggnog | Domain-Containing protein(COG5038) |
| Kegg | Link to kegg annotations (AT1G63220) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019454768.1) |
| Pfam | C2 domain (PF00168.29) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer