Protein coding transcript 94208

• Transcript: Ll_transcript_378677
• CDS coordinates: 316-804 (+)
• Peptide sequence: MSMGRHEPTYSDLLSGFGAGGDPSHPSLVYQTGHAAYPERMHSLNHEAKLRVHHPWSVMPCSLSLKLVDSNLKESANVDTAYQVRGNLSYSAYGQYPMFSHGHKVEHLHGNLMLPLPSTQYESSRSRELMSTPMSMKTSEAMTLKDGDCKLFGISLRSSHDAQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_378677

• Blastp: Auxin response factor 2A from Lycopersicon with 37.35% of identity
• Blastx: Auxin response factor 2B from Lycopersicon with 38.24% of identity
• Eggnog: auxin response factor(ENOG4110RNJ)
• Kegg: Link to kegg annotations (778240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430107.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;