Protein coding transcript 94209

• Transcript: Ll_transcript_378678
• CDS coordinates: 1-918 (+)
• Peptide sequence: GIEDCHSKRWPDSKWRSLKVRWDETSNIPRPDRVSPWKVEPALAPPALNPLPMPRPKKPRSNAIPPSPDSSVLTRQASSKVSEDPLPTNGFPRVLQGQEFSTLRGNFAESNKSDTAVRSVAWPPVEDKKIDVSTSRKYGSENWMSMGRHEPTYSDLLSGFGAGGDPSHPSLVYQTGHAAYPERMHSLNHEAKLRVHHPWSVMPCSLSLKLVDSNLKESANVDTAYQVRGNLSYSAYGQYPMFSHGHKVEHLHGNLMLPLPSTQYESSRSRELMSTPMSMKTSEAMTLKDGDCKLFGISLRSSHDAQ
• ORF Type: internal

Annotations of Ll_transcript_378678

• Blastp: Auxin response factor 2B from Lycopersicon with 50.32% of identity
• Blastx: Auxin response factor 2B from Lycopersicon with 50.32% of identity
• Eggnog: auxin response factor(ENOG4110RNJ)
• Kegg: Link to kegg annotations (101249712)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430108.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;