Protein coding transcript 94224

• Transcript: Ll_transcript_378714
• CDS coordinates: 126-1196 (+)
• Peptide sequence: MKFHMDESPERRFSGVVTGMSDLDPYKWPKSKWRCLMIRRDEDIGANHQNQVSPWEIDHSASFAPLSVQSSSRLKKLWTGLQDASHSHLVTGISRNAEKAKVGGNGFSDMEEYIRSPEVLQGQENTGFMSLHYGCDTVTKQPGLETSSPSHISVASTGVRKVNAAEFMRIHPSSYAGFTEANRFPRVLQGQEIGPLRPFTGKVDLNLGAWGKPNIDYTTYNLHQTTKSNFHSLGPEVLQTAYFPYGDMHKASQGSSIFCCNPTSFRRDHGPFNTPSTQSGVMRNELGLPELAIPNEQKLQDDISGAAVASLGENLRIQNHDKFKGKVNACKLFGFPLCGETTTENLQNSSKRSCTK*
• ORF Type: complete

Annotations of Ll_transcript_378714

• Blastp: Auxin response factor 4 from Arabidopsis with 36.39% of identity
• Blastx: Auxin response factor 4 from Arabidopsis with 38.82% of identity
• Eggnog: auxin response factor(ENOG4111D9H)
• Kegg: Link to kegg annotations (AT5G60450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014498033.1)
• Pfam: Auxin response factor (PF06507.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;