Protein coding transcript 94251

• Transcript: Ll_transcript_378941
• CDS coordinates: 279-788 (+)
• Peptide sequence: MQSDTSTSAPPTSGGRIRHRKRSSEVIPEDSKANGTRLLVNDKSKYKSMIIRAYSSIWMIGGFVLIIYMGHLYITAMVVVIQIFMAKELFNLLRRAHEDRQLPGFRLLNWHFFFTAMLFVYGRTLSPRLVNTVTSDMVLYRLVSSLIKYHMVICYSLYIAGDMHINFIL*
• ORF Type: complete

Annotations of Ll_transcript_378941

• Blastp: Phosphatidate cytidylyltransferase 2 from Arabidopsis with 73.91% of identity
• Blastx: Phosphatidate cytidylyltransferase 2 from Arabidopsis with 73.91% of identity
• Eggnog: phosphatidate Cytidylyltransferase(COG0575)
• Kegg: Link to kegg annotations (AT4G22340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439978.1)
• Pfam: Cytidylyltransferase family (PF01148.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;