Protein coding transcript 94253

• Transcript: Ll_transcript_378944
• CDS coordinates: 478-1104 (+)
• Peptide sequence: MHNDTSTSAPPTSGGRIRHRKRSNEVIPEDSKANGTRLLVNDKSKYKSMIIRAYSSIWMIGGFVLIIYMGHLYITAMVVVIQIFMAKELFNLLRRAHEDRQLPGFRLLNWHFFFTAMLFVYGRTLSPRLVNTVTSDMVLYRLVSSLIKYHMVICYSLYISGFMWFILTLKKKMYKYQFGQYAWTHMILIVVFGQSSFAVASIFEGIFW*
• ORF Type: complete

Annotations of Ll_transcript_378944

• Blastp: Phosphatidate cytidylyltransferase 1 from Solanum with 80.29% of identity
• Blastx: Phosphatidate cytidylyltransferase 1 from Solanum with 80.29% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (102597765)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419797.1)
• Pfam: Cytidylyltransferase family (PF01148.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;