Transcript | Ll_transcript_378948 |
---|---|
CDS coordinates | 478-861 (+) |
Peptide sequence | MHNDTSTSAPPTSGGRIRHRKRSNEVIPEDSKANGTRLLVNDKSKYKSMIIRAYSSIWMIGGFVLIIYMGHLYITAMVVVIQIFMAKELFNLLRRAHEDRQLPGFRLLNWYLTQILASQQCICCFED* |
ORF Type | complete |
Blastp | Phosphatidate cytidylyltransferase 1 from Solanum with 78.57% of identity |
---|---|
Blastx | Phosphatidate cytidylyltransferase 1 from Solanum with 78.57% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (102597765) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419797.1) |
Pfam | Cytidylyltransferase family (PF01148.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer