Transcript | Ll_transcript_378951 |
---|---|
CDS coordinates | 1837-2172 (+) |
Peptide sequence | MGRSQWLTCPRKDLSTGWLQCDPGPIFKPEYIPLPGLLSNLLPWKEIAVLPVQWHALWLGLFASIIAPFGGFFASGFKRAFKIKDFGDSIPGHGGFTDRMDCQVHSCCFNI* |
ORF Type | complete |
Blastp | Phosphatidate cytidylyltransferase 2 from Arabidopsis with 79.82% of identity |
---|---|
Blastx | Phosphatidate cytidylyltransferase 2 from Arabidopsis with 76.92% of identity |
Eggnog | phosphatidate Cytidylyltransferase(COG0575) |
Kegg | Link to kegg annotations (AT4G22340) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439978.1) |
Pfam | Cytidylyltransferase family (PF01148.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer