Protein coding transcript 94272

• Transcript: Ll_transcript_378970
• CDS coordinates: 279-1109 (+)
• Peptide sequence: MQSDTSTSAPPTSGGRIRHRKRSSEVIPEDSKANGTRLLVNDKSKYKSMIIRAYSSIWMIGGFVLIIYMGHLYITAMVVVIQIFMAKELFNLLRRAHEDRQLPGFRLLNWHFFFTAMLFVYGRTLSPRLVNTVTSDMVLYRLVSSLIKYHMVICYSLYISGFMWFILTLKKKMYKYQFGQYAWTHMILIVVFGQSSFAVASIFEGIFWFLLPASLIVINDIAAYFFGFFFGRTPLIKLSPKKTWEGFIGASVTTIISAFLLASIMGRSQWLTCPRKD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_378970

• Blastp: Phosphatidate cytidylyltransferase 2 from Arabidopsis with 80.14% of identity
• Blastx: Phosphatidate cytidylyltransferase 2 from Arabidopsis with 80.14% of identity
• Eggnog: phosphatidate Cytidylyltransferase(COG0575)
• Kegg: Link to kegg annotations (AT4G22340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439978.1)
• Pfam: Cytidylyltransferase family (PF01148.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;