Protein coding transcript 94299

• Transcript: Ll_transcript_379131
• CDS coordinates: 2-331 (+)
• Peptide sequence: KKCKYIKIKTHFYYLDILIYIYIYDFFTLLCFSCIRDDSFPEYFSLPTLISGLQRCGKSCRLRWINYLRPDIRRGRFTHEEEKLIISLHGVVGNRFESLHCSYTKYFEL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_379131

• Blastp: Transcription factor MYB61 from Arabidopsis with 67.27% of identity
• Blastx: Transcription factor MYB61 from Arabidopsis with 64.91% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT1G09540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423233.1)
• Pfam: Myb-like DNA-binding domain (PF13921.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;