Protein coding transcript 94375

• Transcript: Ll_transcript_377202
• CDS coordinates: 208-717 (+)
• Peptide sequence: MNGEGGGGVKRDMGTRKRGKESGERRYKGIRMRKWGKWVAEIREPNKRSRIWLGSYSTPVAAARAYDTAVFYLRGPSARLNFPELLTCDNGAVLANSDMSAAFIRKKATEVGARVDALQATHHHHNVAVATERVVSDGGVENRSGHFSERVDLNKIPEPENSDCDFDTN*
• ORF Type: complete

Annotations of Ll_transcript_377202

• Blastp: Ethylene-responsive transcription factor ERF011 from Arabidopsis with 61.35% of identity
• Blastx: Ethylene-responsive transcription factor ERF008 from Arabidopsis with 63.91% of identity
• Eggnog: Transcription factor(ENOG410YR77)
• Kegg: Link to kegg annotations (AT3G50260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444679.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;