Protein coding transcript 94376

• Transcript: Ll_transcript_377206
• CDS coordinates: 208-708 (+)
• Peptide sequence: MNGEGGGGVKRDMGTRKRGKESGERRYKGIRMRKWGKWVAEIREPNKRSRIWLGSYSTPIAAARAYDTAVFYLRGPSARLNFPDLLSRESAAVLANCDLSPAFIRKKAAEVGARVDALQTTHHHHVAAAPVIISDGDNNRCSQFAKLVDLNKIPEPENSERDWDMN*
• ORF Type: complete

Annotations of Ll_transcript_377206

• Blastp: Ethylene-responsive transcription factor ERF008 from Arabidopsis with 58.08% of identity
• Blastx: Ethylene-responsive transcription factor ERF008 from Arabidopsis with 58.08% of identity
• Eggnog: transcription factor(ENOG41116MV)
• Kegg: Link to kegg annotations (AT2G23340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444679.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;