| Transcript | Ll_transcript_377416 |
|---|---|
| CDS coordinates | 897-1364 (+) |
| Peptide sequence | MHLCWCFLGLHDIWIQFLVHKINAYNIFNIVLVTLLSMQGALRSQLQTNEETETKKSDTLDSNTVLENFLNAKEKLISELNMELHNIETTLSNEREQHINEVKKLNSVLNEKEAALEVMKKELQARPTEKMVDDLRKKVKILQAVGYNSIEAEDWE |
| ORF Type | 3prime_partial |
| Blastp | Protein CASP from Arabidopsis with 70.63% of identity |
|---|---|
| Blastx | Protein CASP from Arabidopsis with 70.63% of identity |
| Eggnog | Cut-like homeobox(ENOG410XPRP) |
| Kegg | Link to kegg annotations (AT3G18480) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019436664.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer