Transcript | Ll_transcript_377418 |
---|---|
CDS coordinates | 865-1332 (+) |
Peptide sequence | MHLCWCFLGLHDIWIQFLVHKINAYNIFNIVLVTLLSMQGALRSQLQTNEETETKKSDTLDSNTVLENFLNAKEKLISELNMELHNIETTLSNEREQHINEVKKLNSVLNEKEAALEVMKKELQARPTEKMVDDLRKKVKILQAVGYNSIEAEDWE |
ORF Type | 3prime_partial |
Blastp | Protein CASP from Arabidopsis with 70.63% of identity |
---|---|
Blastx | Protein CASP from Arabidopsis with 70.63% of identity |
Eggnog | Cut-like homeobox(ENOG410XPRP) |
Kegg | Link to kegg annotations (AT3G18480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436664.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer