| Transcript | Ll_transcript_377620 |
|---|---|
| CDS coordinates | 325-660 (+) |
| Peptide sequence | MKECEKGRREKNVKGSTVCSSPLSDLNNAIILLVTYIQKTFPSPPIIKNSARKVTDIKLNPNHDRRRLIRSVTYMEGEREQQTQRTKTQSDRCKDLLWSSNSGKLQASQAL* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | BES1/BZR1 homolog protein 1 from Arabidopsis with 77.42% of identity |
| Eggnog | Plant protein of unknown function (DUF822)(ENOG41105FJ) |
| Kegg | Link to kegg annotations (AT3G50750) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019444747.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer