Protein coding transcript 94449

• Transcript: Ll_transcript_378720
• CDS coordinates: 62-1261 (+)
• Peptide sequence: MAVSALRSVCSVQLPFFNHRHHHFRLSPNHLNVHSKSKGFTLFSRYAQPQAQDLSSSSHRFQDRIENFPKLVEDIVQTSINTGPRGVLRLAQGLQAFIGVGQEWLNDVSKSTNSTAGLPTEMQLGLLSPFYVRRLFERLGATYIKLGQFIASAPTLFPPEYVQEFQNCFDRAPPISFEEIQSILRKELGRPIESVYEYVDPKPLASASIAQVHGARLKGSGEDVVIKVLKPGIEDILVADLNFVYVVARIFEFLSPEISRTSLVGIVKDIRDSMLEEVDFYKEAANIEAFRKYLEGMGLTRNATAPKVYQYCSTQKVLTMERLYGVPITDLDSIRSFVSNPEASLITALNVWFGSLLACESFHADVHAGNLWLLRDGRIGFLDFGMLYIPRAWFTDGFT*
• ORF Type: complete

Annotations of Ll_transcript_378720

• Blastp: Uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic from Arabidopsis with 73.57% of identity
• Blastx: Uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic from Arabidopsis with 73.27% of identity
• Eggnog: Required, probably indirectly, for the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, the fourth step in ubiquinone biosynthesis (By similarity)(COG0661)
• Kegg: Link to kegg annotations (AT5G05200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460672.1)
• Pfam: ABC1 family (PF03109.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;