Transcript | Ll_transcript_378721 |
---|---|
CDS coordinates | 62-1261 (+) |
Peptide sequence | MAVSALRSVCSVQLPFFNHRHHHFRLSPNHLNVHSKSKGFTLFSRYAQPQAQDLSSSSHRFQDRIENFPKLVEDIVQTSINTGPRGVLRLAQGLQAFIGVGQEWLNDVSKSTNSTAGLPTEMQLGLLSPFYVRRLFERLGATYIKLGQFIASAPTLFPPEYVQEFQNCFDRAPPISFEEIQSILRKELGRPIESVYEYVDPKPLASASIAQVHGARLKGSGEDVVIKVLKPGIEDILVADLNFVYVVARIFEFLSPEISRTSLVGIVKDIRDSMLEEVDFYKEAANIEAFRKYLEGMGLTRNATAPKVYQYCSTQKVLTMERLYGVPITDLDSIRSFVSNPEASLITALNVWFGSLLACESFHADVHAGNLWLLRDGRIGFLDFGMLYIPRAWFTDGFT* |
ORF Type | complete |
Blastp | Uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic from Arabidopsis with 73.57% of identity |
---|---|
Blastx | Uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic from Arabidopsis with 73.27% of identity |
Eggnog | Required, probably indirectly, for the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, the fourth step in ubiquinone biosynthesis (By similarity)(COG0661) |
Kegg | Link to kegg annotations (AT5G05200) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460672.1) |
Pfam | ABC1 family (PF03109.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer