Protein coding transcript 94583

• Transcript: Ll_transcript_377034
• CDS coordinates: 108-1043 (+)
• Peptide sequence: MDGDTQKWFERMKPFLAVVFLQFGFAGMDVLSKAALNKGMSNYVLVVYRHVVAFIVITPFAIILDKKVRVKMTFSIFMKIVALSLLEPVIDQNLYFLGMKYTTATFAAAMTNMLPAITFLMACIIRIEKINIKNIRSQAKVLGTIATVAGAMVMTLLKGPIVEFFGTHGNNSHNQQNGGSNLQHAIKGSIMITIGCFSWAGFMVLQSITLEAYPAELSLTAWICLLGTIEGGIVALVMERGNPSIWSLNWDTKLLAAVYSGIVCSGLAYYIQGVVMRTRGPVFVTAFSPLCMVIVAILGSFILAEQMFLGR*
• ORF Type: complete

Annotations of Ll_transcript_377034

• Blastp: WAT1-related protein At2g37460 from Arabidopsis with 67.88% of identity
• Blastx: WAT1-related protein At2g37460 from Arabidopsis with 66.03% of identity
• Eggnog: Auxin-induced protein(ENOG410YBPN)
• Kegg: Link to kegg annotations (AT2G37460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455573.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;