Protein coding transcript 94589

• Transcript: Ll_transcript_377043
• CDS coordinates: 2562-2984 (+)
• Peptide sequence: MERGNPSIWSLTWDTRLLAAVYSGVVCSGLAYYIQGVVMRTRGPVFVTAFSPLCMVIVAILGSFILSEQMFLGRVIGAIIIIFGLYLVVWGKSKDYNSPRPIIKELSPNNAEHVLPTKQIVEEGNVIKEHFPIIARDEQV*
• ORF Type: complete

Annotations of Ll_transcript_377043

• Blastp: WAT1-related protein At2g37460 from Arabidopsis with 60.48% of identity
• Blastx: WAT1-related protein At2g37460 from Arabidopsis with 59.3% of identity
• Eggnog: Auxin-induced protein(ENOG410YBPN)
• Kegg: Link to kegg annotations (AT2G37460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444391.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;