| Transcript | Ll_transcript_377018 |
|---|---|
| CDS coordinates | 666-1049 (+) |
| Peptide sequence | MENLWTRNWLERAKPFIAVVFLQFGFAGVDVLFKAAMNKGMSNYVLVVYRHAVAFIVITPFAFILDKKIRPKMTISIFMKIVALSLLEPVIDQNLYFLGMKYTTATFAAAMTNIIPAITFFMAYILR* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | WAT1-related protein At2g37460 from Arabidopsis with 69.6% of identity |
| Eggnog | Auxin-induced protein(ENOG410YBPN) |
| Kegg | Link to kegg annotations (AT2G37460) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019459172.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer